(data stored in ACNUC7421 zone)

EMBL: CP000283.PE667

CP000283.PE667       Location/Qualifiers
FT   CDS             complement(754399..754674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37907"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DD2"
FT                   /protein_id="ABE37907.1"
FT                   /translation="MKGLNMSIVEPPLRGEQLNVVLIGRDNRGRWIAREQHGRFGGLFV
FT                   SREHAVKYALFENGRRREAIIELATEVELAFDTMPTAAPVLQRRAA"
     MKGLNMSIVE PPLRGEQLNV VLIGRDNRGR WIAREQHGRF GGLFVSREHA VKYALFENGR        60
     RREAIIELAT EVELAFDTMP TAAPVLQRRA A                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page