(data stored in ACNUC7421 zone)

EMBL: CP000283.PE68

CP000283.PE68        Location/Qualifiers
FT   CDS             83786..84514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0068"
FT                   /product="ribonuclease P protein component"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37308"
FT                   /db_xref="GOA:Q13F31"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F31"
FT                   /protein_id="ABE37308.1"
FT                   /translation="MPNAGLARIGGPIRQKRRRAQLTRPGRSRISRANCPRWPGSTGAV
FT                   HFLGCLRLICEPHHRAYLNLLNNLPGLRRTTREADLSTEQIGAQAPSRLSCPSCHRWWP
FT                   KGAGGAPRPRTQASERLSGPSRDQIMDRLRQRADFIAVAGGLRISGPAFVLQGRRRDDE
FT                   GPVRVGFTVTKKIGTATERNRIRRRMRELVKRADRSFMLPNSDYVLVGRRAALSRDFAV
FT                   MLGDLRSALDRIARRSSKPD"
     MPNAGLARIG GPIRQKRRRA QLTRPGRSRI SRANCPRWPG STGAVHFLGC LRLICEPHHR        60
     AYLNLLNNLP GLRRTTREAD LSTEQIGAQA PSRLSCPSCH RWWPKGAGGA PRPRTQASER       120
     LSGPSRDQIM DRLRQRADFI AVAGGLRISG PAFVLQGRRR DDEGPVRVGF TVTKKIGTAT       180
     ERNRIRRRMR ELVKRADRSF MLPNSDYVLV GRRAALSRDF AVMLGDLRSA LDRIARRSSK       240
     PD                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page