(data stored in ACNUC7421 zone)

EMBL: CP000283.PE69

CP000283.PE69        Location/Qualifiers
FT   CDS             84531..86396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0069"
FT                   /product="protein translocase subunit yidC"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37309"
FT                   /db_xref="GOA:Q13F30"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F30"
FT                   /protein_id="ABE37309.1"
FT                   /translation="MTDNRNTILAVILSGLVLLGWQYFFNIPQMEKQRAAQQAQQQQEA
FT                   AKQQTPPAATTPGAPNAPAAPGAPGAPANQPAANAPVVSRDAAIAASPRIKVETPRLDG
FT                   TLSLKGARIDDLSLSQYHETVDPKSAPIHLFSPSGSANPYYAEFGWVGAAGSNVKLPDQ
FT                   NTLWEQEGSGALTPANPVTLKWDNGEGLTFRRQIAVDDRYLFTIKDDVTNVGGGPVTLY
FT                   PFALISRHGTPHVEGFYILHEGLIGYLGEQGLQEYGYAKIDEAKTVGFKATNAWMGITD
FT                   KYWASALLPDTNAQLQARFSSNQVGATRTYQTDYLEDAKTVPIGGTATATARLFAGAKE
FT                   ARVVGINFPFAGLGGYNQQLGLNHFDLLIDWGWFYFITKPMFLALDFFFHLVGNFGVAI
FT                   LLVTVLVKLIFLPLANKSYASMAKMKAIQPQLLALKERHPDDKAKQQQEMMEIYRKEKI
FT                   NPVAGCLPVLLQIPVFFSLYKVLFVTIEMRHAPFFGWIHDLSAADPTNLFNLFGLIPYD
FT                   PSTLPVIGSYLVLGVWPLVMGFTMWFQMKLNPQPPDPTQQMIFAWMPVIFTFMLAHFPA
FT                   GLVIYWAWNNTLSVIQQAYIMRRNGVKVELWDNLKSAVVKPKKTA"
     MTDNRNTILA VILSGLVLLG WQYFFNIPQM EKQRAAQQAQ QQQEAAKQQT PPAATTPGAP        60
     NAPAAPGAPG APANQPAANA PVVSRDAAIA ASPRIKVETP RLDGTLSLKG ARIDDLSLSQ       120
     YHETVDPKSA PIHLFSPSGS ANPYYAEFGW VGAAGSNVKL PDQNTLWEQE GSGALTPANP       180
     VTLKWDNGEG LTFRRQIAVD DRYLFTIKDD VTNVGGGPVT LYPFALISRH GTPHVEGFYI       240
     LHEGLIGYLG EQGLQEYGYA KIDEAKTVGF KATNAWMGIT DKYWASALLP DTNAQLQARF       300
     SSNQVGATRT YQTDYLEDAK TVPIGGTATA TARLFAGAKE ARVVGINFPF AGLGGYNQQL       360
     GLNHFDLLID WGWFYFITKP MFLALDFFFH LVGNFGVAIL LVTVLVKLIF LPLANKSYAS       420
     MAKMKAIQPQ LLALKERHPD DKAKQQQEMM EIYRKEKINP VAGCLPVLLQ IPVFFSLYKV       480
     LFVTIEMRHA PFFGWIHDLS AADPTNLFNL FGLIPYDPST LPVIGSYLVL GVWPLVMGFT       540
     MWFQMKLNPQ PPDPTQQMIF AWMPVIFTFM LAHFPAGLVI YWAWNNTLSV IQQAYIMRRN       600
     GVKVELWDNL KSAVVKPKKT A                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page