(data stored in ACNUC7421 zone)

EMBL: CP000283.PE71

CP000283.PE71        Location/Qualifiers
FT   CDS             87339..87707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0071"
FT                   /product="protein of unknown function DUF423"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37311"
FT                   /db_xref="GOA:Q13F28"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F28"
FT                   /protein_id="ABE37311.1"
FT                   /translation="MTPLLRVLIVCAGIAGAAGVALAAAAAHVPDASRLGPASSMLLFH
FT                   ASAILAAVLLCERGGVHRIPGLAAGCGFVIGAALFAGDLSLRQFSGHALFPMAAPTGGV
FT                   LLIGSWLLLAVAGLWPRR"
     MTPLLRVLIV CAGIAGAAGV ALAAAAAHVP DASRLGPASS MLLFHASAIL AAVLLCERGG        60
     VHRIPGLAAG CGFVIGAALF AGDLSLRQFS GHALFPMAAP TGGVLLIGSW LLLAVAGLWP       120
     RR                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page