(data stored in ACNUC7421 zone)

EMBL: CP000283.PE73

CP000283.PE73        Location/Qualifiers
FT   CDS             88816..89970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0073"
FT                   /product="Peptidoglycan-binding domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37313"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR009380"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F26"
FT                   /protein_id="ABE37313.1"
FT                   /translation="MTGAKATSSCPGRGAARSAAPQTRDPGSAEPHKPGPRIISAPRRE
FT                   GRRAALHPGHACLFVATLLASLAGNTAAHADLKLCNRMSYVIETAIGIDDKATTATRGW
FT                   LRIDPAQCRVVLQGALSADRVMLHARALAVYGASPIPQNGTDRLCITPENFVIAAARQC
FT                   RSGQTLAPFTEIKPTQQDDGNMVAYLAEDSEYDDEQARLAAIQRLLVIAGYDAAPIDGV
FT                   DGPKTQAALAAFLKSRGLKPDIVSAPDFFDTMIKAVESPSATGLTWCNDTRSRIMAAIA
FT                   EDDGKTITSRGWYRIEPGKCLRPDLSALPKRVFSFAEAVDGNARPITLKDKPLNWGGAT
FT                   LLCTRESKFEISEQGDCSARGLNATGFAPVDLSGGGKTVRFATP"
     MTGAKATSSC PGRGAARSAA PQTRDPGSAE PHKPGPRIIS APRREGRRAA LHPGHACLFV        60
     ATLLASLAGN TAAHADLKLC NRMSYVIETA IGIDDKATTA TRGWLRIDPA QCRVVLQGAL       120
     SADRVMLHAR ALAVYGASPI PQNGTDRLCI TPENFVIAAA RQCRSGQTLA PFTEIKPTQQ       180
     DDGNMVAYLA EDSEYDDEQA RLAAIQRLLV IAGYDAAPID GVDGPKTQAA LAAFLKSRGL       240
     KPDIVSAPDF FDTMIKAVES PSATGLTWCN DTRSRIMAAI AEDDGKTITS RGWYRIEPGK       300
     CLRPDLSALP KRVFSFAEAV DGNARPITLK DKPLNWGGAT LLCTRESKFE ISEQGDCSAR       360
     GLNATGFAPV DLSGGGKTVR FATP                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page