(data stored in ACNUC7421 zone)

EMBL: CP000283.PE76

CP000283.PE76        Location/Qualifiers
FT   CDS             91810..92097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37316"
FT                   /db_xref="GOA:Q13F23"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F23"
FT                   /protein_id="ABE37316.1"
FT                   /translation="MELLMAEFRRIIIKTAEVMMVLLVIITILATAGLGAISGSETSGA
FT                   LAVAGFVLGGVGGLIVSSIFASSFFLILEIAENTRQVLRYYEPKVDGASR"
     MELLMAEFRR IIIKTAEVMM VLLVIITILA TAGLGAISGS ETSGALAVAG FVLGGVGGLI        60
     VSSIFASSFF LILEIAENTR QVLRYYEPKV DGASR                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page