(data stored in ACNUC7421 zone)

EMBL: CP000283.PE81

CP000283.PE81        Location/Qualifiers
FT   CDS             complement(96621..97148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0081"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37321"
FT                   /db_xref="GOA:Q13F18"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13F18"
FT                   /protein_id="ABE37321.1"
FT                   /translation="MALREIIILPDKRLREISKPVAEVTPEIRKLADDMFESMYDAPGI
FT                   GLAAIQIAEPVRLITMDIVRKEGNGKSDPRAFINPEIVGASAEMNVYEEGCLSIPEYYA
FT                   DVERPAVVRIRYTDLDGNVKEEDADGLFATCIQHEIDHLDGVLFVDHLSKLKRAMVVRK
FT                   FEKAAKRGIKYV"
     MALREIIILP DKRLREISKP VAEVTPEIRK LADDMFESMY DAPGIGLAAI QIAEPVRLIT        60
     MDIVRKEGNG KSDPRAFINP EIVGASAEMN VYEEGCLSIP EYYADVERPA VVRIRYTDLD       120
     GNVKEEDADG LFATCIQHEI DHLDGVLFVD HLSKLKRAMV VRKFEKAAKR GIKYV            175
//

If you have problems or comments...

PBIL Back to PBIL home page