(data stored in ACNUC7421 zone)

EMBL: CP000283.PE88

CP000283.PE88        Location/Qualifiers
FT   CDS             103996..104481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0088"
FT                   /product="histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37328"
FT                   /db_xref="GOA:Q13F11"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F11"
FT                   /protein_id="ABE37328.1"
FT                   /translation="MDVSGSVPATTQEPACQRADGIDMPSDWSLSSQLEKDTINIGDLP
FT                   LSRVLVIKDAHYPWLLLVPRRADAVEIIDLDEVEQAQLMTEISRVGRALKEITKCDKLN
FT                   IAALGNMVPQLHVHIIARRSSDAAWPRPVWGVMPPLPHDPEEVQQFISALRRKIWLG"
     MDVSGSVPAT TQEPACQRAD GIDMPSDWSL SSQLEKDTIN IGDLPLSRVL VIKDAHYPWL        60
     LLVPRRADAV EIIDLDEVEQ AQLMTEISRV GRALKEITKC DKLNIAALGN MVPQLHVHII       120
     ARRSSDAAWP RPVWGVMPPL PHDPEEVQQF ISALRRKIWL G                           161
//

If you have problems or comments...

PBIL Back to PBIL home page