(data stored in ACNUC7421 zone)

EMBL: CP000283.PE91

CP000283.PE91        Location/Qualifiers
FT   CDS             complement(106399..107100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0091"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37331"
FT                   /db_xref="GOA:Q13F08"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F08"
FT                   /protein_id="ABE37331.1"
FT                   /translation="MTLAARKDLRLSSQIIDPAILYFGTPVVLIGSCNDDDSFNLAPMS
FT                   SAWWVGQRCMLGLASNSKTTGNILRSGECVLNLPSSDLVGAVDRLARTTGSDPVPQGKL
FT                   HRGYRFEADKFGVSRLTSQKGDAVAAPRALECPVQIEARLMQAHPMAEEDVVWRGHLVA
FT                   LELSVVRIHVHPSIMMDGQDDRIDPDKWRPLIMSFQQYYGLALGRLQHSVLGEIPEAYY
FT                   RPPSRPSQPAG"
     MTLAARKDLR LSSQIIDPAI LYFGTPVVLI GSCNDDDSFN LAPMSSAWWV GQRCMLGLAS        60
     NSKTTGNILR SGECVLNLPS SDLVGAVDRL ARTTGSDPVP QGKLHRGYRF EADKFGVSRL       120
     TSQKGDAVAA PRALECPVQI EARLMQAHPM AEEDVVWRGH LVALELSVVR IHVHPSIMMD       180
     GQDDRIDPDK WRPLIMSFQQ YYGLALGRLQ HSVLGEIPEA YYRPPSRPSQ PAG              233
//

If you have problems or comments...

PBIL Back to PBIL home page