(data stored in ACNUC7421 zone)

EMBL: CP000283.PE97

CP000283.PE97        Location/Qualifiers
FT   CDS             complement(111521..112606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0097"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37337"
FT                   /db_xref="GOA:Q13F02"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13F02"
FT                   /protein_id="ABE37337.1"
FT                   /translation="MSKLPEAKLDVLLAHHASLEAQLLGEVGASEYVRITRELSELNPL
FT                   VEAVKAYREVRDELGDVDALLEDPDTDSEMRAMAEAERDALDAHRAELIQEIRVALLPK
FT                   DAMDERNVMLEIRAGTGGDEASLFAGDLFRMYEKFAALQGWSVEVISASEGSMGGFKEI
FT                   IAEVKGRGAFAKLKFESGVHRVQRVPDTETQGRIHTSAATVAVLPEVEEVDVDIKADDL
FT                   KIDTMRAQGAGGQHVNKTESAIRITHLPTGIVVMMQDSRSQHKNRASAMNILRSRIYDA
FT                   EQQRLDAARSAERKEKVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLPQVIAGEALGE
FT                   LIDALTTEHQAAQLAAQGHAA"
     MSKLPEAKLD VLLAHHASLE AQLLGEVGAS EYVRITRELS ELNPLVEAVK AYREVRDELG        60
     DVDALLEDPD TDSEMRAMAE AERDALDAHR AELIQEIRVA LLPKDAMDER NVMLEIRAGT       120
     GGDEASLFAG DLFRMYEKFA ALQGWSVEVI SASEGSMGGF KEIIAEVKGR GAFAKLKFES       180
     GVHRVQRVPD TETQGRIHTS AATVAVLPEV EEVDVDIKAD DLKIDTMRAQ GAGGQHVNKT       240
     ESAIRITHLP TGIVVMMQDS RSQHKNRASA MNILRSRIYD AEQQRLDAAR SAERKEKVGS       300
     GDRSERIRTY NFPQGRVTDH RINLTLYKLP QVIAGEALGE LIDALTTEHQ AAQLAAQGHA       360
     A                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page