(data stored in ACNUC7421 zone)

EMBL: CP000283.PE98

CP000283.PE98        Location/Qualifiers
FT   CDS             complement(112658..114925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0098"
FT                   /product="PTSINtr with GAF domain, PtsP"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37338"
FT                   /db_xref="GOA:Q13F01"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F01"
FT                   /protein_id="ABE37338.1"
FT                   /translation="MRSTSGGPRVLLRRLRETMAEQVSAQERLDKIVVLIAANMVAEVC
FT                   STYVLRVDNTLELYATEGLNREAVHQTVLNAHEGLVGLVASEATPLNLSDAQSHPAFSF
FT                   RPETGEEIYHSFLGVPILRAGNTLGVLVVQNRAKRTYVEEEVEALQTTAMVLAEMIASG
FT                   ELSALAQPGAEPAARHSIHKTGAILSDGIALGHVVLHEPRVVITNYIAEDLPKEIKRLD
FT                   AALAKLRADLDRLLERGDVADGGEHREVLEAYRMFANDHGWSHRLHEAVATGLTAEAAV
FT                   ERVQSDTRARMLRSTDPYLRDRLHDLEDLGHRLMRQLVGQNHAPSREQLPDNAILIARS
FT                   MGPAALLDYDRTRLRGLVLEEGTANSHVSIVARALGIAAVGEVPNAPGIADPGDAIIVD
FT                   ATSGSIYVRPSAEVEAAYGERVRFRARRQAQYSALRDLACVTKDGQPIDLMINAGLAID
FT                   LPHIDDTGSSGIGLFRTELQFMIGQSLPRSSDQLALYRTVLDAAGSKPVTFRTLDIGGD
FT                   KALPYMETVVEENPALGWRAIRLGLDRPGLLRSQIRALLRAGGGRSLRIMFPMISEVAE
FT                   FDAAKAIVERELTYLRQHGHTLPERVDVGTMVEVPALLYQLDELLKKVDFISVGSNDLF
FT                   QFLYAVDRGNSKVSDRFDTLSTPILRALRHIVRKAKAANRSVSLCGEMASQPLSALALI
FT                   AIGYRALSVSAVSHGPIKAMILEVDAAKAEAAILPLLDAPAGSVSIRHKLAEFAEAHGL
FT                   SL"
     MRSTSGGPRV LLRRLRETMA EQVSAQERLD KIVVLIAANM VAEVCSTYVL RVDNTLELYA        60
     TEGLNREAVH QTVLNAHEGL VGLVASEATP LNLSDAQSHP AFSFRPETGE EIYHSFLGVP       120
     ILRAGNTLGV LVVQNRAKRT YVEEEVEALQ TTAMVLAEMI ASGELSALAQ PGAEPAARHS       180
     IHKTGAILSD GIALGHVVLH EPRVVITNYI AEDLPKEIKR LDAALAKLRA DLDRLLERGD       240
     VADGGEHREV LEAYRMFAND HGWSHRLHEA VATGLTAEAA VERVQSDTRA RMLRSTDPYL       300
     RDRLHDLEDL GHRLMRQLVG QNHAPSREQL PDNAILIARS MGPAALLDYD RTRLRGLVLE       360
     EGTANSHVSI VARALGIAAV GEVPNAPGIA DPGDAIIVDA TSGSIYVRPS AEVEAAYGER       420
     VRFRARRQAQ YSALRDLACV TKDGQPIDLM INAGLAIDLP HIDDTGSSGI GLFRTELQFM       480
     IGQSLPRSSD QLALYRTVLD AAGSKPVTFR TLDIGGDKAL PYMETVVEEN PALGWRAIRL       540
     GLDRPGLLRS QIRALLRAGG GRSLRIMFPM ISEVAEFDAA KAIVERELTY LRQHGHTLPE       600
     RVDVGTMVEV PALLYQLDEL LKKVDFISVG SNDLFQFLYA VDRGNSKVSD RFDTLSTPIL       660
     RALRHIVRKA KAANRSVSLC GEMASQPLSA LALIAIGYRA LSVSAVSHGP IKAMILEVDA       720
     AKAEAAILPL LDAPAGSVSI RHKLAEFAEA HGLSL                                  755
//

If you have problems or comments...

PBIL Back to PBIL home page