(data stored in ACNUC9543 zone)

EMBL: CP000308.PE102

CP000308.PE102       Location/Qualifiers
FT   CDS             121153..122970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0102"
FT                   /product="ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12071"
FT                   /db_xref="GOA:A0A0H2Y3H3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3H3"
FT                   /protein_id="ABG12071.1"
FT                   /translation="MDAMESCKTPGASSVPPTILSVLAGNKKILWGIGLFTAVINLLML
FT                   APAIYMLQVYDRVLASANTMTLLMLTVLVLGVFVFIGLLEWVRSAVVIRLGTQIDMQLN
FT                   QPVFNAAFAANLKGHNTPAAQALNDLTVLRQFATGNALFAFFDAPWFPLYLLVIFLLHP
FT                   WLGMLAAAGAGILVVLAWLNQWICKKPLHDASIITSHATQQANANLRNADVIEAMGMLK
FT                   ALRERWLMQHANFLYQQNLASDKSSRVTAVAKSSRQALQSMMLGLGALLVIYNEITAGV
FT                   MIAGSILIGRVLGPIDQLIAVWKQWSHARLAYQRLSQLLAQHPSSPTGMVLPAPQGKLN
FT                   VTQLMACKPGTHIPVLHSINFELQPGDVLGILGPSGSGKSTLAKLLVASQPTFSGTVRL
FT                   DSADLSRWDKTQLGEFIGYLPQNIQLFRGTVAENIARFGAIDTAKVVAAAQLADVHDLI
FT                   LHLPQGYDTPLGDDGEGLSGGQRQRIALARAMYGIPRLIVLDEPNASLDKEGEQALLAS
FT                   IIQLKQQGCTIVMITHKPELLSGSDYLLFLKNGQMDLFDRTQAVLQNIQGKDKPAVQPE
FT                   AKILNSRSGWSNGVSYGIGPARTTSSPKP"
     MDAMESCKTP GASSVPPTIL SVLAGNKKIL WGIGLFTAVI NLLMLAPAIY MLQVYDRVLA        60
     SANTMTLLML TVLVLGVFVF IGLLEWVRSA VVIRLGTQID MQLNQPVFNA AFAANLKGHN       120
     TPAAQALNDL TVLRQFATGN ALFAFFDAPW FPLYLLVIFL LHPWLGMLAA AGAGILVVLA       180
     WLNQWICKKP LHDASIITSH ATQQANANLR NADVIEAMGM LKALRERWLM QHANFLYQQN       240
     LASDKSSRVT AVAKSSRQAL QSMMLGLGAL LVIYNEITAG VMIAGSILIG RVLGPIDQLI       300
     AVWKQWSHAR LAYQRLSQLL AQHPSSPTGM VLPAPQGKLN VTQLMACKPG THIPVLHSIN       360
     FELQPGDVLG ILGPSGSGKS TLAKLLVASQ PTFSGTVRLD SADLSRWDKT QLGEFIGYLP       420
     QNIQLFRGTV AENIARFGAI DTAKVVAAAQ LADVHDLILH LPQGYDTPLG DDGEGLSGGQ       480
     RQRIALARAM YGIPRLIVLD EPNASLDKEG EQALLASIIQ LKQQGCTIVM ITHKPELLSG       540
     SDYLLFLKNG QMDLFDRTQA VLQNIQGKDK PAVQPEAKIL NSRSGWSNGV SYGIGPARTT       600
     SSPKP                                                                   605
//

If you have problems or comments...

PBIL Back to PBIL home page