(data stored in ACNUC9543 zone)

EMBL: CP000308.PE106

CP000308.PE106       Location/Qualifiers
FT   CDS             complement(126916..127647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0106"
FT                   /product="putative peroxiredoxin/glutaredoxin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12075"
FT                   /db_xref="GOA:A0A0E1NX26"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011906"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NX26"
FT                   /protein_id="ABG12075.1"
FT                   /translation="MFTSQEGKKVPQVTFHTRQGDQWIDVTTDDLFSNKTVIVFSLPGA
FT                   FTPTCSSSHLPRYNELAGVFKQHGVDSILCVSVNDTFVMNAWKSDQHAENITFVPDGNG
FT                   EFTKGMNMLVEKADLGFGPRSWRYSMLVRNGVVEKMFVEPNKPGDPFEVSDADTMLKYL
FT                   APDFKVQESVAVFTKPGCPFCAKAKQMLQDHGLQYEEIVLGKDATTVSLRAVSGRSTVP
FT                   QIFIGGRHIGGSDDLEKYLPA"
     MFTSQEGKKV PQVTFHTRQG DQWIDVTTDD LFSNKTVIVF SLPGAFTPTC SSSHLPRYNE        60
     LAGVFKQHGV DSILCVSVND TFVMNAWKSD QHAENITFVP DGNGEFTKGM NMLVEKADLG       120
     FGPRSWRYSM LVRNGVVEKM FVEPNKPGDP FEVSDADTML KYLAPDFKVQ ESVAVFTKPG       180
     CPFCAKAKQM LQDHGLQYEE IVLGKDATTV SLRAVSGRST VPQIFIGGRH IGGSDDLEKY       240
     LPA                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page