(data stored in ACNUC9543 zone)

EMBL: CP000308.PE110

CP000308.PE110       Location/Qualifiers
FT   CDS             130960..131367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0110"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12079"
FT                   /db_xref="InterPro:IPR009867"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPR0"
FT                   /protein_id="ABG12079.1"
FT                   /translation="MEQSSRRETGTLLLALITGLAINGVCAALFSALVPFSVFPLLTLI
FT                   LAVYCLHQRYLNFAMPQGIPVLASACFLLGILLYSAIVRVEYPAIGSNFVPAVLSVVLV
FT                   FWILFKLRTRKSVQTHTDADIDINNSDQPQQ"
     MEQSSRRETG TLLLALITGL AINGVCAALF SALVPFSVFP LLTLILAVYC LHQRYLNFAM        60
     PQGIPVLASA CFLLGILLYS AIVRVEYPAI GSNFVPAVLS VVLVFWILFK LRTRKSVQTH       120
     TDADIDINNS DQPQQ                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page