(data stored in ACNUC9543 zone)

EMBL: CP000308.PE114

CP000308.PE114       Location/Qualifiers
FT   CDS             142629..143585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0114"
FT                   /product="putative periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12083"
FT                   /db_xref="GOA:A0A0E1NSG0"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR033893"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSG0"
FT                   /protein_id="ABG12083.1"
FT                   /translation="MYRRLLLAAAVTAAMCSAVQAAPLVVGFSQIGSESGWRSAETKVA
FT                   KQEAEKRGITLKIADAQQKQENQIKAVRSFIAQGVDAIFIAPVVATGWTPVLQEAKEAK
FT                   IPVFLLDRMIEVNDPSLYTAAVASDSVYEGKVAGEWLLQDVAGKPCNVVELQGTVGSSV
FT                   AINRKKGFADGIASAPGVKIIRSQSGDFTRSKGKEVMESFIKAEQNGKNICAVYAHNDD
FT                   MAIGAIQAIKEAGLKPGSDIKIVSIDGVPDIFKAMSSGEANATVELTPNMAGPALDALI
FT                   VLKKDGTQPPKFIQTESRLLQPDTAKQEYELKKSLGY"
     MYRRLLLAAA VTAAMCSAVQ AAPLVVGFSQ IGSESGWRSA ETKVAKQEAE KRGITLKIAD        60
     AQQKQENQIK AVRSFIAQGV DAIFIAPVVA TGWTPVLQEA KEAKIPVFLL DRMIEVNDPS       120
     LYTAAVASDS VYEGKVAGEW LLQDVAGKPC NVVELQGTVG SSVAINRKKG FADGIASAPG       180
     VKIIRSQSGD FTRSKGKEVM ESFIKAEQNG KNICAVYAHN DDMAIGAIQA IKEAGLKPGS       240
     DIKIVSIDGV PDIFKAMSSG EANATVELTP NMAGPALDAL IVLKKDGTQP PKFIQTESRL       300
     LQPDTAKQEY ELKKSLGY                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page