(data stored in ACNUC9543 zone)

EMBL: CP000308.PE115

CP000308.PE115       Location/Qualifiers
FT   CDS             143671..145161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0115"
FT                   /product="putative sugar transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12084"
FT                   /db_xref="GOA:A0A0H2Y287"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y287"
FT                   /protein_id="ABG12084.1"
FT                   /translation="MEILLEVRGLSVEFPGVKALDSVDFSLQRGEVVALLGENGAGKST
FT                   LIKALTGVYKRSAGEVLLDGKAVCPIDTADAQLMGIGTVYQEVNLLPNISVAANLFIGR
FT                   EPLRWGLIDHNKMNQQAAKLLTGYGLTLDVQQPLANFSIAIQQIVAIARAVDLSAKVLI
FT                   LDEPTASLDAKEVSMLLDILCQLRDQGIGMVFVTHFLDQVYRISDRITVLRNGKLVGTK
FT                   TVAELPRIELVQMMLGHSFDEQLLKRGEHSITNKNPLVEFKNYGRRGVVENFDLSVSPG
FT                   EIVGLAGLLGSGRTETAQLIFGITTPDTGEAKIQGKPVKIRTPRKASKFGFGYCPEDRK
FT                   TEGIVGAATVRENIILALQAQRGWLRPLSMREQTQIADDFIQQLGIRTPSPEQQIQYLS
FT                   GGNQQKVLLARWLATKPRFLILDEPTRGIDVGAHAEIIRLIEKLCDEGLALLIISSELE
FT                   ELAGYADRIIVLRDRRHVAQLDHDEISVPAIMQAIAVQ"
     MEILLEVRGL SVEFPGVKAL DSVDFSLQRG EVVALLGENG AGKSTLIKAL TGVYKRSAGE        60
     VLLDGKAVCP IDTADAQLMG IGTVYQEVNL LPNISVAANL FIGREPLRWG LIDHNKMNQQ       120
     AAKLLTGYGL TLDVQQPLAN FSIAIQQIVA IARAVDLSAK VLILDEPTAS LDAKEVSMLL       180
     DILCQLRDQG IGMVFVTHFL DQVYRISDRI TVLRNGKLVG TKTVAELPRI ELVQMMLGHS       240
     FDEQLLKRGE HSITNKNPLV EFKNYGRRGV VENFDLSVSP GEIVGLAGLL GSGRTETAQL       300
     IFGITTPDTG EAKIQGKPVK IRTPRKASKF GFGYCPEDRK TEGIVGAATV RENIILALQA       360
     QRGWLRPLSM REQTQIADDF IQQLGIRTPS PEQQIQYLSG GNQQKVLLAR WLATKPRFLI       420
     LDEPTRGIDV GAHAEIIRLI EKLCDEGLAL LIISSELEEL AGYADRIIVL RDRRHVAQLD       480
     HDEISVPAIM QAIAVQ                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page