(data stored in ACNUC9543 zone)

EMBL: CP000308.PE120

CP000308.PE120       Location/Qualifiers
FT   CDS             complement(148766..150289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0120"
FT                   /product="putative magnesium chelatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12089"
FT                   /db_xref="GOA:A0A0E1NR73"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NR73"
FT                   /protein_id="ABG12089.1"
FT                   /translation="MSLATIHTRATLGIQAPPVAVEVHISNGLPGLILVGLPETTVKEA
FT                   RDRVRSALINSGFNFPAKRITVSLAPADLPKEGGRYDLPIALAILAASEQIPADKLAHY
FT                   EFLGELALSGALRRVSGAIPAALTCSEANRQLILPTANGLEIGLIPQGNSWVADHLLAV
FT                   CGFLQGENPLAQGQPFEPAPSPDNHLDLHDIIGQSQAKRALEIAAAGGHNLLLLGPPGT
FT                   GKTMLATRLTGLLPPLTDQEALEAAAITGLLHSNALPTQWRCRAFRAPHHSASMAALIG
FT                   GGSIPRPGEISLAHNGVLFLDELPEFERRVLDSLREPLESGEIIISRAAAKICFPAKVQ
FT                   LIAAMNPSPSGHYQGVHNRTPPQQILRYLAKLSGPFLDRFDLSIEVPLLPAGMLGAQKN
FT                   QGESSATVKQRVLQARQRQMDRAGKINTQLTSQEVAEFCYLAPEDAAFLEQVLLTLGLS
FT                   VRAWHHILKVARTIADLAQEKTIQKSHLSEALSYRCMDRLLLQLHKSLM"
     MSLATIHTRA TLGIQAPPVA VEVHISNGLP GLILVGLPET TVKEARDRVR SALINSGFNF        60
     PAKRITVSLA PADLPKEGGR YDLPIALAIL AASEQIPADK LAHYEFLGEL ALSGALRRVS       120
     GAIPAALTCS EANRQLILPT ANGLEIGLIP QGNSWVADHL LAVCGFLQGE NPLAQGQPFE       180
     PAPSPDNHLD LHDIIGQSQA KRALEIAAAG GHNLLLLGPP GTGKTMLATR LTGLLPPLTD       240
     QEALEAAAIT GLLHSNALPT QWRCRAFRAP HHSASMAALI GGGSIPRPGE ISLAHNGVLF       300
     LDELPEFERR VLDSLREPLE SGEIIISRAA AKICFPAKVQ LIAAMNPSPS GHYQGVHNRT       360
     PPQQILRYLA KLSGPFLDRF DLSIEVPLLP AGMLGAQKNQ GESSATVKQR VLQARQRQMD       420
     RAGKINTQLT SQEVAEFCYL APEDAAFLEQ VLLTLGLSVR AWHHILKVAR TIADLAQEKT       480
     IQKSHLSEAL SYRCMDRLLL QLHKSLM                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page