(data stored in ACNUC9543 zone)

EMBL: CP000308.PE121

CP000308.PE121       Location/Qualifiers
FT   CDS             150912..152558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0121"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12090"
FT                   /db_xref="GOA:A0A0E1NNK9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNK9"
FT                   /protein_id="ABG12090.1"
FT                   /translation="MNGAQWVVQALRAQGVDTVFGYPGGAIMPVYDALYDGGVEHLLCR
FT                   HEQGAAIAAIGYARATGKVGVCIATSGPGATNLITGLADALLDSVPVIAITGQVGSALI
FT                   GTDAFQEIDVLGLSLACTKHSFLVESLDALPEIMAEAFAIATSGRPGPVLIDIPKDIQL
FT                   AVGELTPHLKPVEEHSVDSAAELQHAWDMLANAQKPMLYVGGGVGMAQAVPALRDFIAM
FT                   TGIPAVATLKGLGAPDIAHPCYLGMLGMHGTKAANFAVQDCDLLVAVGARFDDRVTGKL
FT                   NTFASKAKVIHMDIDPAELGKLRQVHVALQGNLNVLLPALQQPLNIQSWRDEVMALKQQ
FT                   HHWRYDHPGQAIYAPLLLKQISERKAPETVVTTDVGQHQMWTAQHMNFTRPENFITSSG
FT                   LGTMGFGVPAAVGAQMARPDDMVICVSGDGSFMMNVQELGTIKRKQLPLKIVLLDNQRL
FT                   GMVRQWQQLFFDGRYSETNLSDNPDFITLASAFDIPGQRITRKDQVDAALDALFNSEGP
FT                   YLLQVSIDELENVWPLVPPGAGNETMLEKIS"
     MNGAQWVVQA LRAQGVDTVF GYPGGAIMPV YDALYDGGVE HLLCRHEQGA AIAAIGYARA        60
     TGKVGVCIAT SGPGATNLIT GLADALLDSV PVIAITGQVG SALIGTDAFQ EIDVLGLSLA       120
     CTKHSFLVES LDALPEIMAE AFAIATSGRP GPVLIDIPKD IQLAVGELTP HLKPVEEHSV       180
     DSAAELQHAW DMLANAQKPM LYVGGGVGMA QAVPALRDFI AMTGIPAVAT LKGLGAPDIA       240
     HPCYLGMLGM HGTKAANFAV QDCDLLVAVG ARFDDRVTGK LNTFASKAKV IHMDIDPAEL       300
     GKLRQVHVAL QGNLNVLLPA LQQPLNIQSW RDEVMALKQQ HHWRYDHPGQ AIYAPLLLKQ       360
     ISERKAPETV VTTDVGQHQM WTAQHMNFTR PENFITSSGL GTMGFGVPAA VGAQMARPDD       420
     MVICVSGDGS FMMNVQELGT IKRKQLPLKI VLLDNQRLGM VRQWQQLFFD GRYSETNLSD       480
     NPDFITLASA FDIPGQRITR KDQVDAALDA LFNSEGPYLL QVSIDELENV WPLVPPGAGN       540
     ETMLEKIS                                                                548
//

If you have problems or comments...

PBIL Back to PBIL home page