(data stored in ACNUC9543 zone)

EMBL: CP000308.PE122

CP000308.PE122       Location/Qualifiers
FT   CDS             152555..152812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0122"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12091"
FT                   /db_xref="GOA:A0A0E1NP06"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NP06"
FT                   /protein_id="ABG12091.1"
FT                   /translation="MIQHQLSIQARFRPEMLERVLRVVRHRGFQVCAMNMSPMIDAGNV
FT                   NIELTVASQRPVDLLSSQLSKLMDVACVEILQPNTLQIRA"
     MIQHQLSIQA RFRPEMLERV LRVVRHRGFQ VCAMNMSPMI DAGNVNIELT VASQRPVDLL        60
     SSQLSKLMDV ACVEILQPNT LQIRA                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page