(data stored in ACNUC9543 zone)

EMBL: CP000308.PE123

CP000308.PE123       Location/Qualifiers
FT   CDS             152835..153761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0123"
FT                   /product="branched chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12092"
FT                   /db_xref="GOA:A0A0E1NWI3"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWI3"
FT                   /protein_id="ABG12092.1"
FT                   /translation="MTKKADYIWFNGEMVPWAEAKVHVMSHALHYGTSVFEGVRCYESH
FT                   KGPVVFRHREHMQRLHDSAKIYRMPVSQSVDELMEACRATLRKNNLTSAYIRPLVFIGD
FT                   VGMGVNPPEGYNTDVIIAAFPWGAYLGAEALEQGIDAMVSSWNRVAPNTIPTAAKAGGN
FT                   YLSSLLVGSEARRHGYQEGIALDVHGYLSEGAGENLFEVKDGILFTPPFTSSALPGITR
FT                   DAIIKLAKDMGLEVREQVLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGIGKRGPVT
FT                   AKIQQAFFGLFTGETEDKWGWLDQVNP"
     MTKKADYIWF NGEMVPWAEA KVHVMSHALH YGTSVFEGVR CYESHKGPVV FRHREHMQRL        60
     HDSAKIYRMP VSQSVDELME ACRATLRKNN LTSAYIRPLV FIGDVGMGVN PPEGYNTDVI       120
     IAAFPWGAYL GAEALEQGID AMVSSWNRVA PNTIPTAAKA GGNYLSSLLV GSEARRHGYQ       180
     EGIALDVHGY LSEGAGENLF EVKDGILFTP PFTSSALPGI TRDAIIKLAK DMGLEVREQV       240
     LSRESLYLAD EVFMSGTAAE ITPVRSVDGI QVGIGKRGPV TAKIQQAFFG LFTGETEDKW       300
     GWLDQVNP                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page