(data stored in ACNUC9543 zone)

EMBL: CP000308.PE127

CP000308.PE127       Location/Qualifiers
FT   CDS             complement(158147..158608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0127"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12096"
FT                   /db_xref="InterPro:IPR010351"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRW1"
FT                   /protein_id="ABG12096.1"
FT                   /translation="MKAKSKKTLYALLLIGSVLLGYFFWLSLRPVEIVAVHKDRNFSAV
FT                   LVRDFPVTDKGKINWWLENKSRLKDKYNIPNPAPDGFFSITIWDFGDGYKEEGKYDRRC
FT                   FEDMKTSKNCIDKNSLMIIRNSQYNVMSFTLDSGIYQLKNGEIVKMKHE"
     MKAKSKKTLY ALLLIGSVLL GYFFWLSLRP VEIVAVHKDR NFSAVLVRDF PVTDKGKINW        60
     WLENKSRLKD KYNIPNPAPD GFFSITIWDF GDGYKEEGKY DRRCFEDMKT SKNCIDKNSL       120
     MIIRNSQYNV MSFTLDSGIY QLKNGEIVKM KHE                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page