(data stored in ACNUC9543 zone)

EMBL: CP000308.PE13

CP000308.PE13        Location/Qualifiers
FT   CDS             complement(11470..12894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0013"
FT                   /product="putative membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11982"
FT                   /db_xref="GOA:A0A0E1NQP5"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQP5"
FT                   /protein_id="ABG11982.1"
FT                   /translation="MIKSARSMAGLPWIAAMAFFMQALDATILNTALPSIAESLNRSPL
FT                   TMQSAIISYTLTVAMLIPVSGWLADRFGTRRIFILAVSLFTFGSLLCALSGSLAFLVAS
FT                   RVIQGIGGAMMMPVARLALIRAYPRSELLPVLNFVTIPGLVGPVMGPLLGGLLVTYTTW
FT                   HWIFILNIPIGLLGIFYARKYMPNFTMPKRTFDFVGFLLFGISLVMISTSLEIMGRPEI
FT                   ADYLPAATLLGGLLMLIFYIFHAKGHPNPLIGLPLFKTRTFSVGIAGNVASRLGTGCVP
FT                   FLMPLMLQVGFGYSALIAGCMMAPTAIGSIMAKSAVTQVLRSLGYRKVLVGITLIIGVL
FT                   IASFALQSPGMSAWMMILPLFILGIAMSTQFTAMNTITLADLTDNNASSGNSVLAVTQQ
FT                   LSISFGIAISATVLRFYDGLSLGGNVDHFHYTFITMGIVTLLSSLVFLLLKPRDGDNLI
FT                   QGRNVKKVAPQVKNNV"
     MIKSARSMAG LPWIAAMAFF MQALDATILN TALPSIAESL NRSPLTMQSA IISYTLTVAM        60
     LIPVSGWLAD RFGTRRIFIL AVSLFTFGSL LCALSGSLAF LVASRVIQGI GGAMMMPVAR       120
     LALIRAYPRS ELLPVLNFVT IPGLVGPVMG PLLGGLLVTY TTWHWIFILN IPIGLLGIFY       180
     ARKYMPNFTM PKRTFDFVGF LLFGISLVMI STSLEIMGRP EIADYLPAAT LLGGLLMLIF       240
     YIFHAKGHPN PLIGLPLFKT RTFSVGIAGN VASRLGTGCV PFLMPLMLQV GFGYSALIAG       300
     CMMAPTAIGS IMAKSAVTQV LRSLGYRKVL VGITLIIGVL IASFALQSPG MSAWMMILPL       360
     FILGIAMSTQ FTAMNTITLA DLTDNNASSG NSVLAVTQQL SISFGIAISA TVLRFYDGLS       420
     LGGNVDHFHY TFITMGIVTL LSSLVFLLLK PRDGDNLIQG RNVKKVAPQV KNNV             474
//

If you have problems or comments...

PBIL Back to PBIL home page