(data stored in ACNUC9543 zone)

EMBL: CP000308.PE133

CP000308.PE133       Location/Qualifiers
FT   CDS             163645..165087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0133"
FT                   /product="colicin"
FT                   /note="putative partial protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12102"
FT                   /db_xref="GOA:A0A0E1NS99"
FT                   /db_xref="InterPro:IPR016128"
FT                   /db_xref="InterPro:IPR036302"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NS99"
FT                   /protein_id="ABG12102.1"
FT                   /translation="MGLLMQQQRVNADLETAKITEPQRVENARLTAEAAEKAARDRRIS
FT                   EEIAATEAKRQRMENERLAEQERQRVEGTKQQVSEASCAQQASAWQNRFTLPALQPSGS
FT                   AQYSFAASGMSAVGEAAELHNSFLAAQEQLSAIATISASGSVAAMIALGIYQTKVGESS
FT                   ERPPGWNVSPKFVGSISLSAMGLPATESLASQGEMALPVRMRIIDAKDWIGCTEIYAVK
FT                   TGVAGVLPKVKVGAAQYDESTGVYTFTTDSTPPRTLIFTPAQPPGAETRPILAPPGSTP
FT                   ATLQHTGEMIIKPVITPTILPLPQLYARDFHDYIIWFPADSGLEPVYVYLNSPYGKTTA
FT                   KGKYSGRDFNPDKAGGPIKNLDWKEIKIRGEGVDEVKLHTRRFGELEDNKLMIERLEKI
FT                   LTNKLTATDIDKHFYTHEIRELERYRMLGIPDDVNDKSVWNDAHTATLEDFKINEKTQP
FT                   LYTSEAEDAYIKAELKNSLGSK"
     MGLLMQQQRV NADLETAKIT EPQRVENARL TAEAAEKAAR DRRISEEIAA TEAKRQRMEN        60
     ERLAEQERQR VEGTKQQVSE ASCAQQASAW QNRFTLPALQ PSGSAQYSFA ASGMSAVGEA       120
     AELHNSFLAA QEQLSAIATI SASGSVAAMI ALGIYQTKVG ESSERPPGWN VSPKFVGSIS       180
     LSAMGLPATE SLASQGEMAL PVRMRIIDAK DWIGCTEIYA VKTGVAGVLP KVKVGAAQYD       240
     ESTGVYTFTT DSTPPRTLIF TPAQPPGAET RPILAPPGST PATLQHTGEM IIKPVITPTI       300
     LPLPQLYARD FHDYIIWFPA DSGLEPVYVY LNSPYGKTTA KGKYSGRDFN PDKAGGPIKN       360
     LDWKEIKIRG EGVDEVKLHT RRFGELEDNK LMIERLEKIL TNKLTATDID KHFYTHEIRE       420
     LERYRMLGIP DDVNDKSVWN DAHTATLEDF KINEKTQPLY TSEAEDAYIK AELKNSLGSK       480
//

If you have problems or comments...

PBIL Back to PBIL home page