(data stored in ACNUC9543 zone)

EMBL: CP000308.PE135

CP000308.PE135       Location/Qualifiers
FT   CDS             165603..165854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0135"
FT                   /product="colicin"
FT                   /note="putative partial protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12104"
FT                   /db_xref="GOA:A0A0E1NS96"
FT                   /db_xref="InterPro:IPR003060"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR037146"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NS96"
FT                   /protein_id="ABG12104.1"
FT                   /translation="MTFWREVANEPELVGQFKPNNVSLMKKGLSPHPVLSEKVGGRDTF
FT                   EIHHVNSIKSGGAVYDVDNLRVATPKRHIEIHSRRGGK"
     MTFWREVANE PELVGQFKPN NVSLMKKGLS PHPVLSEKVG GRDTFEIHHV NSIKSGGAVY        60
     DVDNLRVATP KRHIEIHSRR GGK                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page