(data stored in ACNUC9543 zone)

EMBL: CP000308.PE136

CP000308.PE136       Location/Qualifiers
FT   CDS             165856..166113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0136"
FT                   /product="colicin immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12105"
FT                   /db_xref="GOA:A0A0E1NNA5"
FT                   /db_xref="InterPro:IPR000290"
FT                   /db_xref="InterPro:IPR035900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNA5"
FT                   /protein_id="ABG12105.1"
FT                   /translation="MELKEKYEDYTEHEFLEFIRNICEVNTDSQSLHSSWVRHFTKITE
FT                   HPSGSDLIYYPEDGADDSPEGILELVKKWRAENGKPGFKK"
     MELKEKYEDY TEHEFLEFIR NICEVNTDSQ SLHSSWVRHF TKITEHPSGS DLIYYPEDGA        60
     DDSPEGILEL VKKWRAENGK PGFKK                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page