(data stored in ACNUC9543 zone)

EMBL: CP000308.PE138

CP000308.PE138       Location/Qualifiers
FT   CDS             complement(166748..167566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0138"
FT                   /product="putative chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12107"
FT                   /db_xref="GOA:A0A0E1NXY2"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXY2"
FT                   /protein_id="ABG12107.1"
FT                   /translation="MHMRKWLSVSNNIMLSRINRRLRGLLLLMTTCRVLTLPALTIGVL
FT                   IMSALATSAVASVIAERTRIVFSEGSTEESLQLVNSNSYPVAVQVWVDDGNLMATPDKA
FT                   VSPILVLPPVFRLQPQAQRSLRLILSGGSKLPADRESAFWLNIYEIPPKATPKSGDESF
FT                   VTLALRMQYKVFYRPKNLPAPGDILGKALTFSLERNGDSALIKVNNPTPYYASFAALTI
FT                   GSAEGPPEMVAPFSQLDFPLNRAPISDNKTVNFDLIDDLGNRNSFSHELK"
     MHMRKWLSVS NNIMLSRINR RLRGLLLLMT TCRVLTLPAL TIGVLIMSAL ATSAVASVIA        60
     ERTRIVFSEG STEESLQLVN SNSYPVAVQV WVDDGNLMAT PDKAVSPILV LPPVFRLQPQ       120
     AQRSLRLILS GGSKLPADRE SAFWLNIYEI PPKATPKSGD ESFVTLALRM QYKVFYRPKN       180
     LPAPGDILGK ALTFSLERNG DSALIKVNNP TPYYASFAAL TIGSAEGPPE MVAPFSQLDF       240
     PLNRAPISDN KTVNFDLIDD LGNRNSFSHE LK                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page