(data stored in ACNUC9543 zone)

EMBL: CP000308.PE142

CP000308.PE142       Location/Qualifiers
FT   CDS             complement(172366..172896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0142"
FT                   /product="putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12111"
FT                   /db_xref="GOA:A0A0E1NQQ9"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQQ9"
FT                   /protein_id="ABG12111.1"
FT                   /translation="MKKITLAIALFSASTTVAMSASNNTITFQGEVTAQTCSVTVNGLE
FT                   ANPVVLLPTVSSSDLDASGQTKGKTTFTLGVSGCTSGSDDLDIKTVFIGSLVTATGNLQ
FT                   NTGTAGNVELQLLKDATTTTGIDLNSGLAQDGIVLLAGDTSAEHDFAVQYYATGQSTPG
FT                   SVIASVQYAVSYL"
     MKKITLAIAL FSASTTVAMS ASNNTITFQG EVTAQTCSVT VNGLEANPVV LLPTVSSSDL        60
     DASGQTKGKT TFTLGVSGCT SGSDDLDIKT VFIGSLVTAT GNLQNTGTAG NVELQLLKDA       120
     TTTTGIDLNS GLAQDGIVLL AGDTSAEHDF AVQYYATGQS TPGSVIASVQ YAVSYL           176
//

If you have problems or comments...

PBIL Back to PBIL home page