(data stored in ACNUC9543 zone)

EMBL: CP000308.PE158

CP000308.PE158       Location/Qualifiers
FT   CDS             191274..192038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0158"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12127"
FT                   /db_xref="GOA:A0A0H2Y4M6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012752"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4M6"
FT                   /protein_id="ABG12127.1"
FT                   /translation="MANICWIYYMPVHASIEPLGWESEFFQRQSAKLIFSDSAPPLNPA
FT                   ELAAFTLVQAKVPTHRLDLIDALSQLDFHLVEGEIDLSLVVGEKEGIGTENATSEPNMG
FT                   AYSLRVATEADIPQLRRVAASAFALSRFRAPWYDAQDSGRFYALWVEKAVLGTFDHQCL
FT                   LVLDPTDQPVGFVTLRDLQDGSARIGLLAVFPGAQSKGIGLRLMSAAKQWCQHHGLHRL
FT                   RVATQMSNIAALRLYIRSGASIESTAYWLCRG"
     MANICWIYYM PVHASIEPLG WESEFFQRQS AKLIFSDSAP PLNPAELAAF TLVQAKVPTH        60
     RLDLIDALSQ LDFHLVEGEI DLSLVVGEKE GIGTENATSE PNMGAYSLRV ATEADIPQLR       120
     RVAASAFALS RFRAPWYDAQ DSGRFYALWV EKAVLGTFDH QCLLVLDPTD QPVGFVTLRD       180
     LQDGSARIGL LAVFPGAQSK GIGLRLMSAA KQWCQHHGLH RLRVATQMSN IAALRLYIRS       240
     GASIESTAYW LCRG                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page