(data stored in ACNUC9543 zone)

EMBL: CP000308.PE16

CP000308.PE16        Location/Qualifiers
FT   CDS             complement(21480..21623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11985"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y438"
FT                   /protein_id="ABG11985.1"
FT                   /translation="MSLPVKKAEFYGYFSPDRNKNNQLIHKIKNDFHFYGKYFFNLYLS
FT                   YR"
     MSLPVKKAEF YGYFSPDRNK NNQLIHKIKN DFHFYGKYFF NLYLSYR                      47
//

If you have problems or comments...

PBIL Back to PBIL home page