(data stored in ACNUC9543 zone)

EMBL: CP000308.PE160

CP000308.PE160       Location/Qualifiers
FT   CDS             193172..194428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0160"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12129"
FT                   /db_xref="GOA:A0A0E1NVR8"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR032896"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVR8"
FT                   /protein_id="ABG12129.1"
FT                   /translation="MSLAKASIWTACSTLIKIGVGLLVVKLLAVTFGPSGVGQAGNFRQ
FT                   LIIVLGVLSGAGIFNGITKYVAEYHQQPERLRAMLGTSSTIVLGFSTLLALVFLLAAKP
FT                   VSIALFGHADYQNVVRAIAFIQMGIAYGNLFLAILKGYRDAMGNALAIIGGSLIGVVAY
FT                   YICFQIGGYSGALVGLGLVPALVVLPAAAMLYRRRTIPLRYLKPHWDKALASHLGKFTL
FT                   MALITSVTLPVAYVMMRHLLANNYGWDAVGIWQGVSSISDAYLQFITASFTVYLLPTLS
FT                   RLKDKGAISREIFRSLKFVLPAVAAASLTVWLLRDFAIWLLFSHQFTAMRDLFAWQLVG
FT                   DVLKVGSYVFGYLVIAKASLRFYILAEVSQFLLLTGFAYWLIPMNGSLGAAQAYMATYI
FT                   VYFALCSCAFLVYRRHSAP"
     MSLAKASIWT ACSTLIKIGV GLLVVKLLAV TFGPSGVGQA GNFRQLIIVL GVLSGAGIFN        60
     GITKYVAEYH QQPERLRAML GTSSTIVLGF STLLALVFLL AAKPVSIALF GHADYQNVVR       120
     AIAFIQMGIA YGNLFLAILK GYRDAMGNAL AIIGGSLIGV VAYYICFQIG GYSGALVGLG       180
     LVPALVVLPA AAMLYRRRTI PLRYLKPHWD KALASHLGKF TLMALITSVT LPVAYVMMRH       240
     LLANNYGWDA VGIWQGVSSI SDAYLQFITA SFTVYLLPTL SRLKDKGAIS REIFRSLKFV       300
     LPAVAAASLT VWLLRDFAIW LLFSHQFTAM RDLFAWQLVG DVLKVGSYVF GYLVIAKASL       360
     RFYILAEVSQ FLLLTGFAYW LIPMNGSLGA AQAYMATYIV YFALCSCAFL VYRRHSAP         418
//

If you have problems or comments...

PBIL Back to PBIL home page