(data stored in ACNUC9543 zone)

EMBL: CP000308.PE161

CP000308.PE161       Location/Qualifiers
FT   CDS             194451..195536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12130"
FT                   /db_xref="GOA:Q1CBP2"
FT                   /db_xref="InterPro:IPR009993"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBP2"
FT                   /protein_id="ABG12130.1"
FT                   /translation="MITLTHVLGSDIPHHNLTVLRFFNDVLAKCLPVEQVRHFMVAAKE
FT                   TAPFSSFPQLDINTYSDKKALAEAVIARAQADRSARFFWHGQFNVTLWLALLSGKIKPG
FT                   QVYWHVWGADLYEDAKSLKFRLFYLLRRIAQGRVGHVFATRGDLIHYQQRHPRVPASLL
FT                   YFPTRMDPALTAINIDKPLAGPMTILVGNSGDTTNRHIEALKAIHQQFGPDVRVIIPMG
FT                   YPANNEAYIEQVRQAGLALFSQDNLRILTEQIPFDDYLNILRECDLGYFIFNRQQGIGT
FT                   LCLLTQFGVPFVLSRKNPFWQDLAEQHIPVFFYGDTLDEPMIREAQRQLAGLDKQAIAF
FT                   FNPNYIEGWKQALALAAGEHP"
     MITLTHVLGS DIPHHNLTVL RFFNDVLAKC LPVEQVRHFM VAAKETAPFS SFPQLDINTY        60
     SDKKALAEAV IARAQADRSA RFFWHGQFNV TLWLALLSGK IKPGQVYWHV WGADLYEDAK       120
     SLKFRLFYLL RRIAQGRVGH VFATRGDLIH YQQRHPRVPA SLLYFPTRMD PALTAINIDK       180
     PLAGPMTILV GNSGDTTNRH IEALKAIHQQ FGPDVRVIIP MGYPANNEAY IEQVRQAGLA       240
     LFSQDNLRIL TEQIPFDDYL NILRECDLGY FIFNRQQGIG TLCLLTQFGV PFVLSRKNPF       300
     WQDLAEQHIP VFFYGDTLDE PMIREAQRQL AGLDKQAIAF FNPNYIEGWK QALALAAGEH       360
     P                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page