(data stored in ACNUC9543 zone)

EMBL: CP000308.PE169

CP000308.PE169       Location/Qualifiers
FT   CDS             complement(203677..204897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0169"
FT                   /product="putative protoheme IX biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12138"
FT                   /db_xref="GOA:A0A0E1NTD6"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTD6"
FT                   /protein_id="ABG12138.1"
FT                   /translation="MLRVLLLFLVLTVGIVLGPMLAGHQGYVLIQTDNYNVTTSVTGLA
FT                   IMLVLLLVAFFIVEWVLRRIFRTGARTRGWFLGRKRTRARNQMKAALIKLAEGDFLQVE
FT                   KLLTRNADHAEQPMVNYLLAAEAAQQRGDEFRTNQYLERAAEVADGDQLPVNITRVRIQ
FT                   LAQGHIHAARHGVDRLLDQAPRHPEVLRLAEQAYLRSGAYRSLLDILPAMSKTQIHTPE
FT                   EVAALEQQAYIGIMNQCMADEGSEGLKRWWKDQSRKVRNEIPLQVALAEHLIECDDHDV
FT                   AQKIILDSLKHQYDERLALLIPRLKAGNPEPLEKSLRQQIKQHGATPLLNSTLGQLMLK
FT                   HGEWEKASEAFKAALAQRPDGYDYAWLADALDKLHRPEDAAQARREGLLLTLRQNGESS
FT                   ALTKLIH"
     MLRVLLLFLV LTVGIVLGPM LAGHQGYVLI QTDNYNVTTS VTGLAIMLVL LLVAFFIVEW        60
     VLRRIFRTGA RTRGWFLGRK RTRARNQMKA ALIKLAEGDF LQVEKLLTRN ADHAEQPMVN       120
     YLLAAEAAQQ RGDEFRTNQY LERAAEVADG DQLPVNITRV RIQLAQGHIH AARHGVDRLL       180
     DQAPRHPEVL RLAEQAYLRS GAYRSLLDIL PAMSKTQIHT PEEVAALEQQ AYIGIMNQCM       240
     ADEGSEGLKR WWKDQSRKVR NEIPLQVALA EHLIECDDHD VAQKIILDSL KHQYDERLAL       300
     LIPRLKAGNP EPLEKSLRQQ IKQHGATPLL NSTLGQLMLK HGEWEKASEA FKAALAQRPD       360
     GYDYAWLADA LDKLHRPEDA AQARREGLLL TLRQNGESSA LTKLIH                      406
//

If you have problems or comments...

PBIL Back to PBIL home page