(data stored in ACNUC9543 zone)

EMBL: CP000308.PE173

CP000308.PE173       Location/Qualifiers
FT   CDS             complement(207963..208172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0173"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12142"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y2E9"
FT                   /protein_id="ABG12142.1"
FT                   /translation="MRLLLKNTKNILFEEYLANYCWKRDQSNTLPINRKESKAISTIVK
FT                   PLYARITGSNEFLGVISADHRAAA"
     MRLLLKNTKN ILFEEYLANY CWKRDQSNTL PINRKESKAI STIVKPLYAR ITGSNEFLGV        60
     ISADHRAAA                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page