(data stored in ACNUC9543 zone)

EMBL: CP000308.PE175

CP000308.PE175       Location/Qualifiers
FT   CDS             complement(211032..211352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0175"
FT                   /product="frataxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12144"
FT                   /db_xref="GOA:Q1CBM8"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBM8"
FT                   /protein_id="ABG12144.1"
FT                   /translation="MNDSEFHQLADQLMLYIEETLDSFTGDSDIDYETNGGVMTLTFEN
FT                   GSKIVINRQEPLHQVWLATKAGGYHFNYRDGHWYCSRSGEEFLAKLSEAASAQAGENVS
FT                   FG"
     MNDSEFHQLA DQLMLYIEET LDSFTGDSDI DYETNGGVMT LTFENGSKIV INRQEPLHQV        60
     WLATKAGGYH FNYRDGHWYC SRSGEEFLAK LSEAASAQAG ENVSFG                      106
//

If you have problems or comments...

PBIL Back to PBIL home page