(data stored in ACNUC9543 zone)

EMBL: CP000308.PE179

CP000308.PE179       Location/Qualifiers
FT   CDS             213466..214377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0179"
FT                   /product="tyrosine recombinase XerC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12148"
FT                   /db_xref="GOA:A0A0E1NMV4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMV4"
FT                   /protein_id="ABG12148.1"
FT                   /translation="MTEFSASLAPQVEAFLRYLSIERQLSPLTVTSYRRQLSALMEIGE
FT                   QMGLAHWQTLDAAQVRSLVSRSKRAGLHASSLALRLSALRSFLNWLVSQGVLPANPAKG
FT                   VSTPRSGRHLPKNIDVDEVNKLLSIDLNDPLAVRDRAMLEVMYGAGLRLSELVGMNCKH
FT                   VDLASGDVWVMGKGSKERKVPLGKTAVTWLQHWLALRELFEPQDDAIFLANTGKRISAR
FT                   NVQKRFAEWGVKQGVSSHIHPHKLRHSFATHMLESSGDLRAVQELLGHANLTTTQIYTH
FT                   LDFQHLATVYDAAHPRAKRGKS"
     MTEFSASLAP QVEAFLRYLS IERQLSPLTV TSYRRQLSAL MEIGEQMGLA HWQTLDAAQV        60
     RSLVSRSKRA GLHASSLALR LSALRSFLNW LVSQGVLPAN PAKGVSTPRS GRHLPKNIDV       120
     DEVNKLLSID LNDPLAVRDR AMLEVMYGAG LRLSELVGMN CKHVDLASGD VWVMGKGSKE       180
     RKVPLGKTAV TWLQHWLALR ELFEPQDDAI FLANTGKRIS ARNVQKRFAE WGVKQGVSSH       240
     IHPHKLRHSF ATHMLESSGD LRAVQELLGH ANLTTTQIYT HLDFQHLATV YDAAHPRAKR       300
     GKS                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page