(data stored in ACNUC9543 zone)

EMBL: CP000308.PE183

CP000308.PE183       Location/Qualifiers
FT   CDS             218585..219802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12152"
FT                   /db_xref="InterPro:IPR008322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNW8"
FT                   /protein_id="ABG12152.1"
FT                   /translation="MPRHIYIATTTDTKGQELAYVSELIQATGLTTVTVDLSTKESQRD
FT                   SGADICAETVAGYHPDGRQAVFCGDRGQAINAMAIAFERFMVSRVDVAALLGMGGSGGT
FT                   ALITPAMQRLPIGIPKLMVSTMASGDVSGYIGASDIAMMYSVTDIAGLNRISRRVLSNA
FT                   AHQVAGAVYFAQEASPVDDKPALGLTMFGVTTPCIQAVSAELSDEYDCLVFHATGSGGK
FT                   AMEKLAESGLLAGVLDLTTTEVCDLLFDGVLACGPERFDAIAHTHIPYVGSCGALDMVN
FT                   FGSPATIPAKYADRLFYKHNAQVTLMRTTEQENIEMARWIGEKLNRCQGEVRFLIPEGG
FT                   FSALDAPGQPFWDEKALTAFIRTLEETVIQTDKRRVVHYPFNINDPLFAQAAIENFKEI
FT                   VNRPSH"
     MPRHIYIATT TDTKGQELAY VSELIQATGL TTVTVDLSTK ESQRDSGADI CAETVAGYHP        60
     DGRQAVFCGD RGQAINAMAI AFERFMVSRV DVAALLGMGG SGGTALITPA MQRLPIGIPK       120
     LMVSTMASGD VSGYIGASDI AMMYSVTDIA GLNRISRRVL SNAAHQVAGA VYFAQEASPV       180
     DDKPALGLTM FGVTTPCIQA VSAELSDEYD CLVFHATGSG GKAMEKLAES GLLAGVLDLT       240
     TTEVCDLLFD GVLACGPERF DAIAHTHIPY VGSCGALDMV NFGSPATIPA KYADRLFYKH       300
     NAQVTLMRTT EQENIEMARW IGEKLNRCQG EVRFLIPEGG FSALDAPGQP FWDEKALTAF       360
     IRTLEETVIQ TDKRRVVHYP FNINDPLFAQ AAIENFKEIV NRPSH                       405
//

If you have problems or comments...

PBIL Back to PBIL home page