(data stored in ACNUC9543 zone)

EMBL: CP000308.PE186

CP000308.PE186       Location/Qualifiers
FT   CDS             complement(222355..223245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0186"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12155"
FT                   /db_xref="GOA:A0A0E1NMZ3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMZ3"
FT                   /protein_id="ABG12155.1"
FT                   /translation="MDKQQTRQGIFFALAAYFIWGLAPAYFKLIQQVPADEILTHRVIW
FT                   SFFFMLILLTVSRHWPQVRDACKNRKRLLLLAVTAVLIASNWLLFIWAVNHNHMLEASL
FT                   GYFINPLVNVLFGMLFLGERFRRMQWVAVALAFAGVLIQLWQFGSLPVIGLGLAITFAL
FT                   YGLLRKKLGVDAQTGMLIETMWLLPVAAVYLFFIADSPTSHLSANAWSLNLLLAAAGVI
FT                   TTIPLLFFTAAATRLRLSTLGFFQYLGPTLMFILAVTFYGETIGNDKMVTFIFIWAALL
FT                   LFTLDALYTQRKLRR"
     MDKQQTRQGI FFALAAYFIW GLAPAYFKLI QQVPADEILT HRVIWSFFFM LILLTVSRHW        60
     PQVRDACKNR KRLLLLAVTA VLIASNWLLF IWAVNHNHML EASLGYFINP LVNVLFGMLF       120
     LGERFRRMQW VAVALAFAGV LIQLWQFGSL PVIGLGLAIT FALYGLLRKK LGVDAQTGML       180
     IETMWLLPVA AVYLFFIADS PTSHLSANAW SLNLLLAAAG VITTIPLLFF TAAATRLRLS       240
     TLGFFQYLGP TLMFILAVTF YGETIGNDKM VTFIFIWAAL LLFTLDALYT QRKLRR           296
//

If you have problems or comments...

PBIL Back to PBIL home page