(data stored in ACNUC9543 zone)

EMBL: CP000308.PE19

CP000308.PE19        Location/Qualifiers
FT   CDS             24909..26636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0019"
FT                   /product="isocitrate dehydrogenase kinase/phosphatase"
FT                   /EC_number="2.7.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11988"
FT                   /db_xref="GOA:Q1CC34"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC34"
FT                   /protein_id="ABG11988.1"
FT                   /translation="MVAKLEQLIAQTILQGFDAQYGRFLEVTAGAQHRFEQADWHAVQQ
FT                   AMKKRIHLYDHHVGLVVEQLKYITDQRHFDVEFLARVKEIYTGLLPDYPRFEIAESFFN
FT                   SVYCRLFKHRDLTPDKLFVFSSQPERRFREIPRPLARDFIPKGDLSGMLQMVLNDLSLR
FT                   LHWENLSRDIDYIVMAIRQAFTDEQLASAHFQIANELFYRNKAAWLVGKLRLNGDIYPF
FT                   LLPIHHNESGELFIDTCLTSKAEASIVFGFARSYFMVYVPLPAAMVEWLREILPGKSTA
FT                   ELYTAIGCQKHGKTESYREYLAFIHQSSEQFIIAPGVKGMVMLVFTLPSFDRVFKVIKD
FT                   QFAPQKEVTQARVLECYQLVKEHDRVGRMADTQEYENFVIDKHRISPELLAELQHEVPE
FT                   KLEDLGDKIVIKHLYMERRMTPLNLYMEQADDQQLKDAIEEYGNAIKQLAAANIFPGDM
FT                   LFKNFGVTRHGRVVFYDYDEICYMTEVNFRDIPPPRYPEDEMASEPWYSVSPNDVFPEE
FT                   FRHFLCSDRKVRHFFEEMHGDLFQASYWRGLQQRIRDGHVEDVFAYRRKQRFSQRALN"
     MVAKLEQLIA QTILQGFDAQ YGRFLEVTAG AQHRFEQADW HAVQQAMKKR IHLYDHHVGL        60
     VVEQLKYITD QRHFDVEFLA RVKEIYTGLL PDYPRFEIAE SFFNSVYCRL FKHRDLTPDK       120
     LFVFSSQPER RFREIPRPLA RDFIPKGDLS GMLQMVLNDL SLRLHWENLS RDIDYIVMAI       180
     RQAFTDEQLA SAHFQIANEL FYRNKAAWLV GKLRLNGDIY PFLLPIHHNE SGELFIDTCL       240
     TSKAEASIVF GFARSYFMVY VPLPAAMVEW LREILPGKST AELYTAIGCQ KHGKTESYRE       300
     YLAFIHQSSE QFIIAPGVKG MVMLVFTLPS FDRVFKVIKD QFAPQKEVTQ ARVLECYQLV       360
     KEHDRVGRMA DTQEYENFVI DKHRISPELL AELQHEVPEK LEDLGDKIVI KHLYMERRMT       420
     PLNLYMEQAD DQQLKDAIEE YGNAIKQLAA ANIFPGDMLF KNFGVTRHGR VVFYDYDEIC       480
     YMTEVNFRDI PPPRYPEDEM ASEPWYSVSP NDVFPEEFRH FLCSDRKVRH FFEEMHGDLF       540
     QASYWRGLQQ RIRDGHVEDV FAYRRKQRFS QRALN                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page