(data stored in ACNUC9543 zone)

EMBL: CP000308.PE191

CP000308.PE191       Location/Qualifiers
FT   CDS             complement(227590..228210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0191"
FT                   /product="putative homoserine/homoserine lactone efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12160"
FT                   /db_xref="GOA:A0A0E1P024"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P024"
FT                   /protein_id="ABG12160.1"
FT                   /translation="MTLDWWLTYLLTTLILSLSPGSGAINTMSTAISHGTRGVVASIGG
FT                   LQLGLAVHIVLVGVGLGALVSQSLLAFEILKWLGAAYLIWLGIQQWRAAGSLDLHALAN
FT                   SMPRRKLFKRAVFVNLTNPKSIVFLAALFPQFVLPQQPQVAQYLILGSTSVIVDIIVMI
FT                   GYATLATRIARWIKSPQQMKLLNRIFGGLFMLIGALLATARKV"
     MTLDWWLTYL LTTLILSLSP GSGAINTMST AISHGTRGVV ASIGGLQLGL AVHIVLVGVG        60
     LGALVSQSLL AFEILKWLGA AYLIWLGIQQ WRAAGSLDLH ALANSMPRRK LFKRAVFVNL       120
     TNPKSIVFLA ALFPQFVLPQ QPQVAQYLIL GSTSVIVDII VMIGYATLAT RIARWIKSPQ       180
     QMKLLNRIFG GLFMLIGALL ATARKV                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page