(data stored in ACNUC9543 zone)

EMBL: CP000308.PE194

CP000308.PE194       Location/Qualifiers
FT   CDS             230540..231739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12163"
FT                   /db_xref="InterPro:IPR004954"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNT1"
FT                   /protein_id="ABG12163.1"
FT                   /translation="MSDINVTSPHFIPMKSPITARLDNSDLIDERPQKINFLGNKLNSI
FT                   ADVNIDSKNKKITINIAEKKFSSDYIPEEYIYIAVWDAKGKMVFQKKLSDAEIKEEKIE
FT                   LPFEVGYQLEMYHPIPSRLVSSPDLYSIIDSNSPFTLLVMTPLGVTNPKMESYPTDIIE
FT                   ADFIHPNSVSVGVNADVIEPASTAEPTTSTPIAPDIPSASTDPIVSTSTRTGIDSTTKL
FT                   MVSFQFKLLGVCDYDIATVTIDEESKLAGIKIVTDTPHCHFGDELYASIKVTDKQGHIT
FT                   FEEKLYGTNANISNTIIPFEKGYKLDIFHAEPSRLRVSSGDSDTLIPESKQNSFIMTSI
FT                   GIENTRQGSAEAIISDQFDTEKLVQDMSSFGDSSIAPVDNVYGYMGEKNHYQNVVSHVE
FT                   "
     MSDINVTSPH FIPMKSPITA RLDNSDLIDE RPQKINFLGN KLNSIADVNI DSKNKKITIN        60
     IAEKKFSSDY IPEEYIYIAV WDAKGKMVFQ KKLSDAEIKE EKIELPFEVG YQLEMYHPIP       120
     SRLVSSPDLY SIIDSNSPFT LLVMTPLGVT NPKMESYPTD IIEADFIHPN SVSVGVNADV       180
     IEPASTAEPT TSTPIAPDIP SASTDPIVST STRTGIDSTT KLMVSFQFKL LGVCDYDIAT       240
     VTIDEESKLA GIKIVTDTPH CHFGDELYAS IKVTDKQGHI TFEEKLYGTN ANISNTIIPF       300
     EKGYKLDIFH AEPSRLRVSS GDSDTLIPES KQNSFIMTSI GIENTRQGSA EAIISDQFDT       360
     EKLVQDMSSF GDSSIAPVDN VYGYMGEKNH YQNVVSHVE                              399
//

If you have problems or comments...

PBIL Back to PBIL home page