(data stored in ACNUC9543 zone)

EMBL: CP000308.PE2

CP000308.PE2         Location/Qualifiers
FT   CDS             complement(803..1264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0002"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11971"
FT                   /db_xref="GOA:A0A0E1NNG4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNG4"
FT                   /protein_id="ABG11971.1"
FT                   /translation="MSEIYQIDNLDRSILKALMENARTPYAELAKNLTVSPGTIHVRVE
FT                   KMRQAGIITAACVHVNPKQLGYDVCCFIGIILKSAKDYPSALKKLESLEEVVEAYYTTG
FT                   HYSIFIKVMCKSIDALQQVLINKIQTIDEIQSTETLISLQNPIMRTIVP"
     MSEIYQIDNL DRSILKALME NARTPYAELA KNLTVSPGTI HVRVEKMRQA GIITAACVHV        60
     NPKQLGYDVC CFIGIILKSA KDYPSALKKL ESLEEVVEAY YTTGHYSIFI KVMCKSIDAL       120
     QQVLINKIQT IDEIQSTETL ISLQNPIMRT IVP                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page