(data stored in ACNUC9543 zone)

EMBL: CP000308.PE200

CP000308.PE200       Location/Qualifiers
FT   CDS             complement(238583..239251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0200"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12169"
FT                   /db_xref="GOA:A0A0E1NNP1"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNP1"
FT                   /protein_id="ABG12169.1"
FT                   /translation="MFSFTVQQRMTALVWLSLFHIVIITSSNYLVQLPIAIFGFHTTWG
FT                   AFTFPFIFLATDLTVRIFGAPLARRIILSVMVPALLISYLISALFYQGSWQGFPALTSF
FT                   NLVVARIAVASFMAYVLGQILDVQVFNRLRQRNAWWVAPTAAMFFGNISDTMAFFFIAF
FT                   YRSSDPFMAAHWVEIALVDYSFKLLICMLFFLPAYGVMLNVLLKYFARQTGQPVLATER
FT                   "
     MFSFTVQQRM TALVWLSLFH IVIITSSNYL VQLPIAIFGF HTTWGAFTFP FIFLATDLTV        60
     RIFGAPLARR IILSVMVPAL LISYLISALF YQGSWQGFPA LTSFNLVVAR IAVASFMAYV       120
     LGQILDVQVF NRLRQRNAWW VAPTAAMFFG NISDTMAFFF IAFYRSSDPF MAAHWVEIAL       180
     VDYSFKLLIC MLFFLPAYGV MLNVLLKYFA RQTGQPVLAT ER                          222
//

If you have problems or comments...

PBIL Back to PBIL home page