(data stored in ACNUC9543 zone)

EMBL: CP000308.PE205

CP000308.PE205       Location/Qualifiers
FT   CDS             244122..244541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0205"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12174"
FT                   /db_xref="InterPro:IPR019635"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNM1"
FT                   /protein_id="ABG12174.1"
FT                   /translation="MSKLPLLFIAVVVLIVVLATRQYWQKKQQDAENDRAPVRSVQVEV
FT                   VDKREVLAPNRRSRQREEIVAEEKRYEVYFRPLSSGIEIKNSLGLSGGNEIKSGSEIKM
FT                   VLPQQEYNRIEQGAQGILRLQGTRYIGFIPDAPHP"
     MSKLPLLFIA VVVLIVVLAT RQYWQKKQQD AENDRAPVRS VQVEVVDKRE VLAPNRRSRQ        60
     REEIVAEEKR YEVYFRPLSS GIEIKNSLGL SGGNEIKSGS EIKMVLPQQE YNRIEQGAQG       120
     ILRLQGTRYI GFIPDAPHP                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page