(data stored in ACNUC9543 zone)

EMBL: CP000308.PE210

CP000308.PE210       Location/Qualifiers
FT   CDS             248214..249167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0210"
FT                   /product="cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12179"
FT                   /db_xref="GOA:A0A0E1NND7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NND7"
FT                   /protein_id="ABG12179.1"
FT                   /translation="MANNARKAKTKALKGGWREQWRYSWVNAIADMMRQPMATLLTVMV
FT                   ISISLTLPSVCYIVWKNVSQAAEQWYPTPQLTVYLDKALDDNAAENVVVTLKAEAGVEK
FT                   VNYLSREEAMGEFRNWSGFGGALDMLEENPLPAVAIITPKLNFQSAETLNTLRDRISQV
FT                   EGVAEVRMDDSWFARLAALTGLVGQVAAMVGVLMVVAVFLVIGNSVRLSIFSRRDTINV
FT                   MKLLGATDGFILRPFLNGGAMLGFGGAVLSLILSEALVWQLGSVVKQVATVFGTQFTLH
FT                   GLSWDESLLLVLISAMIGWIAAWLATVQHLRRFTPQ"
     MANNARKAKT KALKGGWREQ WRYSWVNAIA DMMRQPMATL LTVMVISISL TLPSVCYIVW        60
     KNVSQAAEQW YPTPQLTVYL DKALDDNAAE NVVVTLKAEA GVEKVNYLSR EEAMGEFRNW       120
     SGFGGALDML EENPLPAVAI ITPKLNFQSA ETLNTLRDRI SQVEGVAEVR MDDSWFARLA       180
     ALTGLVGQVA AMVGVLMVVA VFLVIGNSVR LSIFSRRDTI NVMKLLGATD GFILRPFLNG       240
     GAMLGFGGAV LSLILSEALV WQLGSVVKQV ATVFGTQFTL HGLSWDESLL LVLISAMIGW       300
     IAAWLATVQH LRRFTPQ                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page