(data stored in ACNUC9543 zone)

EMBL: CP000308.PE217

CP000308.PE217       Location/Qualifiers
FT   CDS             255322..256248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0217"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12186"
FT                   /db_xref="GOA:A0A0E1NUG1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUG1"
FT                   /protein_id="ABG12186.1"
FT                   /translation="MSEQFLYFLQQMFNGITLGSTYALIAIGYTMVYGIIGMINFAHGE
FT                   VYMISSYVSFIVIAALMMVGIDASWLLIGCAFLVSIVIASTYGWSIERVAYKPVRRSKR
FT                   LIALISAIGMSIFLQNYVSLTQGSRDLALPSLVTGQWTLGESNGFAATISTMQLTIWIV
FT                   TFLAMLALTLFIRYSRMGRACRACAEDLKMASLLGINTDRVISLTFVIGALMAAVAGVL
FT                   LGQFYGVINPYIGFMAGMKAFTAAVLGGIGSIPGAMIGGLVLGVAEALTSAYLSTEYKD
FT                   AVSFALLIVVLLVMPTGILGRPEVEKV"
     MSEQFLYFLQ QMFNGITLGS TYALIAIGYT MVYGIIGMIN FAHGEVYMIS SYVSFIVIAA        60
     LMMVGIDASW LLIGCAFLVS IVIASTYGWS IERVAYKPVR RSKRLIALIS AIGMSIFLQN       120
     YVSLTQGSRD LALPSLVTGQ WTLGESNGFA ATISTMQLTI WIVTFLAMLA LTLFIRYSRM       180
     GRACRACAED LKMASLLGIN TDRVISLTFV IGALMAAVAG VLLGQFYGVI NPYIGFMAGM       240
     KAFTAAVLGG IGSIPGAMIG GLVLGVAEAL TSAYLSTEYK DAVSFALLIV VLLVMPTGIL       300
     GRPEVEKV                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page