(data stored in ACNUC9543 zone)

EMBL: CP000308.PE218

CP000308.PE218       Location/Qualifiers
FT   CDS             256245..257531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0218"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12187"
FT                   /db_xref="GOA:A0A0E1NLL5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR021807"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLL5"
FT                   /protein_id="ABG12187.1"
FT                   /translation="MKQLNFVNAIISSFVLLVLASFVMGLQLQLDGTRLVVQGASEVRW
FT                   LWIGAGCLVVFCFQLVRPLIQQGIKKVSGPAWVLPSFDGTTPRQKLLAAVVIIAAVAWP
FT                   FLVSRGSVDIATLTLIYVMLGLGLNVVVGLSGLLVLGYGGFYAIGAYTYALLNHYYGLG
FT                   FWESLPLAGITAALSGFLLGFPVLRLRGDYLAIVTLGFGEIVRILLLNNTEITGGPNGI
FT                   SQIPKPTLFGLEFSRTAKDGGWDTFHNFFGLTYDPSHRIIFLYLVALLLVILTLFVINR
FT                   LLRMPLGRAWEALREDEIACRSLGLSPTKIKLTAFTISAAFAGFAGTLFAARQGFVSPE
FT                   SFTFVESAFVLAIVVLGGMGSQFAVILAAVLLVVSRELMRDLNAYSMLLLGALMVLMMI
FT                   WRPQGLLPMKRPQLKLKVADVKAKQGEQA"
     MKQLNFVNAI ISSFVLLVLA SFVMGLQLQL DGTRLVVQGA SEVRWLWIGA GCLVVFCFQL        60
     VRPLIQQGIK KVSGPAWVLP SFDGTTPRQK LLAAVVIIAA VAWPFLVSRG SVDIATLTLI       120
     YVMLGLGLNV VVGLSGLLVL GYGGFYAIGA YTYALLNHYY GLGFWESLPL AGITAALSGF       180
     LLGFPVLRLR GDYLAIVTLG FGEIVRILLL NNTEITGGPN GISQIPKPTL FGLEFSRTAK       240
     DGGWDTFHNF FGLTYDPSHR IIFLYLVALL LVILTLFVIN RLLRMPLGRA WEALREDEIA       300
     CRSLGLSPTK IKLTAFTISA AFAGFAGTLF AARQGFVSPE SFTFVESAFV LAIVVLGGMG       360
     SQFAVILAAV LLVVSRELMR DLNAYSMLLL GALMVLMMIW RPQGLLPMKR PQLKLKVADV       420
     KAKQGEQA                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page