(data stored in ACNUC9543 zone)

EMBL: CP000308.PE220

CP000308.PE220       Location/Qualifiers
FT   CDS             258310..259041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0220"
FT                   /product="high-affinity branched-chain amino acid
FT                   transport, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12189"
FT                   /db_xref="GOA:A0A0H2Y4U9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4U9"
FT                   /protein_id="ABG12189.1"
FT                   /translation="MESGRGINNNMLSFNQVSAHYGKIQALHQVSLHIQQGEIVTLIGA
FT                   NGAGKTTLLGTLCGEPRATEGNIVFGEQDITHWQTARIMREAIAIVPEGRRVFSRMTVE
FT                   ENLAMGGFFADRQQYQQRIERVYDLFPRLFERRIQRAGTMSGGEQQMLAIGRALMSQPK
FT                   LLLLDEPSLGLAPIIILQIFDTIQQLREEGMTIFLVEQNANQALKLADRGYVLENGRIV
FT                   LEDTGAALLANEAVRSAYLGG"
     MESGRGINNN MLSFNQVSAH YGKIQALHQV SLHIQQGEIV TLIGANGAGK TTLLGTLCGE        60
     PRATEGNIVF GEQDITHWQT ARIMREAIAI VPEGRRVFSR MTVEENLAMG GFFADRQQYQ       120
     QRIERVYDLF PRLFERRIQR AGTMSGGEQQ MLAIGRALMS QPKLLLLDEP SLGLAPIIIL       180
     QIFDTIQQLR EEGMTIFLVE QNANQALKLA DRGYVLENGR IVLEDTGAAL LANEAVRSAY       240
     LGG                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page