(data stored in ACNUC9543 zone)

EMBL: CP000308.PE221

CP000308.PE221       Location/Qualifiers
FT   CDS             259269..259730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12190"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y2N2"
FT                   /protein_id="ABG12190.1"
FT                   /translation="MMDGISNKMDLQGLSAVRSFAFLTADLMLNITNKNGDNHEYKVTS
FT                   SHVNNDKLQGPKGILKATKNHAELKNETIASGEKKTISFDKLHVREIPDREQASYIDNL
FT                   SLNRNIYLDTSADRECRIPTQVLSPDQNVDSGTKKPFWISKYLCITTLY"
     MMDGISNKMD LQGLSAVRSF AFLTADLMLN ITNKNGDNHE YKVTSSHVNN DKLQGPKGIL        60
     KATKNHAELK NETIASGEKK TISFDKLHVR EIPDREQASY IDNLSLNRNI YLDTSADREC       120
     RIPTQVLSPD QNVDSGTKKP FWISKYLCIT TLY                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page