(data stored in ACNUC9543 zone)

EMBL: CP000308.PE222

CP000308.PE222       Location/Qualifiers
FT   CDS             complement(259845..260951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12191"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQQ2"
FT                   /protein_id="ABG12191.1"
FT                   /translation="MNIKNKPLLIGLLLLFLHPTTAAATKWVGNYFYPLANKYSNCNVT
FT                   LLEDNSVAVSFDVTLVADLFETDRGPHLQRWKKIIGTQQDVLLVQNNALLFLYFYHADG
FT                   SADFSIRPGDIQNMSLNGIPVQEIDYNLQEARFVSTHAFSNQSYHVSFNITANALKHIR
FT                   MGATIGGVLHSEGVSYSVRSPQGVAFNQSGNQCEFFDPTTEIAPSHALYIEPKFRLGSA
FT                   IWQLKSLDLDHLLDSTADNHGLHAPLVNGPANRFCIHYPAIGTQNRRYMISASNLNGLA
FT                   ESSRYFQLKDNQGEHIINYKVTLKNHEDSEADFSLPKEKKFIQLKSDTSSGGEAQMCWS
FT                   PRIRVYSTDTTDKGHYTDTLNFTITPLA"
     MNIKNKPLLI GLLLLFLHPT TAAATKWVGN YFYPLANKYS NCNVTLLEDN SVAVSFDVTL        60
     VADLFETDRG PHLQRWKKII GTQQDVLLVQ NNALLFLYFY HADGSADFSI RPGDIQNMSL       120
     NGIPVQEIDY NLQEARFVST HAFSNQSYHV SFNITANALK HIRMGATIGG VLHSEGVSYS       180
     VRSPQGVAFN QSGNQCEFFD PTTEIAPSHA LYIEPKFRLG SAIWQLKSLD LDHLLDSTAD       240
     NHGLHAPLVN GPANRFCIHY PAIGTQNRRY MISASNLNGL AESSRYFQLK DNQGEHIINY       300
     KVTLKNHEDS EADFSLPKEK KFIQLKSDTS SGGEAQMCWS PRIRVYSTDT TDKGHYTDTL       360
     NFTITPLA                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page