(data stored in ACNUC9543 zone)

EMBL: CP000308.PE223

CP000308.PE223       Location/Qualifiers
FT   CDS             complement(261183..261701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12192"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NX55"
FT                   /protein_id="ABG12192.1"
FT                   /translation="MNTIKMAITLLLLSWHTCWAATPLGDIDVKLEVTAQPRIEIEKPH
FT                   GGWYDNIKLHNSPENHAVYEVEVPVAVKLRRQEGYQISIKNPLILTRQSDAFSAIEQTF
FT                   SPAEVRWGNNRTNLRLLSAVPESFSVPPQATRHTTTDYVLQISAKAPAGDNTAGKYHGQ
FT                   LTLVFEVNS"
     MNTIKMAITL LLLSWHTCWA ATPLGDIDVK LEVTAQPRIE IEKPHGGWYD NIKLHNSPEN        60
     HAVYEVEVPV AVKLRRQEGY QISIKNPLIL TRQSDAFSAI EQTFSPAEVR WGNNRTNLRL       120
     LSAVPESFSV PPQATRHTTT DYVLQISAKA PAGDNTAGKY HGQLTLVFEV NS               172
//

If you have problems or comments...

PBIL Back to PBIL home page